Lineage for d3hjoa2 (3hjo A:79-209)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326363Protein Class pi GST [81347] (4 species)
  7. 2326364Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries)
  8. 2326389Domain d3hjoa2: 3hjo A:79-209 [211103]
    Other proteins in same PDB: d3hjoa1, d3hjob1
    automated match to d1gssa1
    complexed with ca, co3, eaa, gsh; mutant

Details for d3hjoa2

PDB Entry: 3hjo (more details), 1.95 Å

PDB Description: crystal structure of glutathione transferase pi y108v mutant in complex with the glutathione conjugate of ethacrynic acid
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3hjoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjoa2 a.45.1.1 (A:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

SCOPe Domain Coordinates for d3hjoa2:

Click to download the PDB-style file with coordinates for d3hjoa2.
(The format of our PDB-style files is described here.)

Timeline for d3hjoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hjoa1