Lineage for d3hjoa1 (3hjo A:1-78)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455762Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2456104Protein Class pi GST [81358] (4 species)
  7. 2456105Species Human (Homo sapiens) [TaxId:9606] [52864] (60 PDB entries)
  8. 2456124Domain d3hjoa1: 3hjo A:1-78 [211102]
    Other proteins in same PDB: d3hjoa2, d3hjob2
    automated match to d1gssa2
    complexed with ca, co3, eaa, gsh; mutant

Details for d3hjoa1

PDB Entry: 3hjo (more details), 1.95 Å

PDB Description: Crystal Structure of Glutathione Transferase Pi Y108V Mutant in Complex with the Glutathione Conjugate of Ethacrynic Acid
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3hjoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjoa1 c.47.1.5 (A:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3hjoa1:

Click to download the PDB-style file with coordinates for d3hjoa1.
(The format of our PDB-style files is described here.)

Timeline for d3hjoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hjoa2