Lineage for d3hjmd1 (3hjm D:2-78)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132391Protein Class pi GST [81358] (4 species)
  7. 2132392Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)
  8. 2132449Domain d3hjmd1: 3hjm D:2-78 [211100]
    Other proteins in same PDB: d3hjma2, d3hjmb2, d3hjmc2, d3hjmd2
    automated match to d1gssa2
    complexed with ca, cl, co3, mes, po4; mutant

Details for d3hjmd1

PDB Entry: 3hjm (more details), 2.1 Å

PDB Description: crystal structure of human glutathione transferase pi y108v mutant
PDB Compounds: (D:) Glutathione S-transferase P

SCOPe Domain Sequences for d3hjmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjmd1 c.47.1.5 (D:2-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtlgl

SCOPe Domain Coordinates for d3hjmd1:

Click to download the PDB-style file with coordinates for d3hjmd1.
(The format of our PDB-style files is described here.)

Timeline for d3hjmd1: