SCOPe 2.07: Domain d3hjmc1: 3hjm C:2-78

Lineage for d3hjmc1 (3hjm C:2-78)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (63 PDB entries)

8. Domain d3hjmc1: 3hjm C:2-78 [211098]
   Other proteins in same PDB: d3hjma2, d3hjmb2, d3hjmc2, d3hjmd2
   automated match to d1gssa2
   complexed with ca, cl, co3, mes, po4; mutant

Details for d3hjmc1

PDB Entry: 3hjm, 2.1 Å

PDB Description: crystal structure of human glutathione transferase pi y108v mutant

PDB Compounds: (C:) Glutathione S-transferase P

SCOPe Domain Sequences for d3hjmc1:

Sequence; same for both SEQRES and ATOM records:

>d3hjmc1 c.47.1.5 (C:2-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtlgl

Timeline for d3hjmc1:

• d3hjmc1 first appeared in SCOPe 2.03
  
• d3hjmc1 appears in SCOPe 2.06
  
• d3hjmc1 appears in the current release, SCOPe 2.08