![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class pi GST [81358] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries) |
![]() | Domain d3hjma1: 3hjm A:2-78 [211094] Other proteins in same PDB: d3hjma2, d3hjmb2, d3hjmc2, d3hjmd2 automated match to d1gssa2 complexed with ca, cl, co3, mes, po4; mutant |
PDB Entry: 3hjm (more details), 2.1 Å
SCOPe Domain Sequences for d3hjma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjma1 c.47.1.5 (A:2-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt lyqsntilrhlgrtlgl
Timeline for d3hjma1: