SCOPe 2.04: Domain d3hjea2: 3hje A:642-704

Lineage for d3hjea2 (3hje A:642-704)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (27 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [225872] (1 PDB entry)

8. Domain d3hjea2: 3hje A:642-704 [211093]
   Other proteins in same PDB: d3hjea1
   automated match to d1iv8a1
   complexed with gol

Details for d3hjea2

PDB Entry: 3hje, 1.9 Å

PDB Description: Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase

PDB Compounds: (A:) 704aa long hypothetical glycosyltransferase

SCOPe Domain Sequences for d3hjea2:

Sequence; same for both SEQRES and ATOM records:

>d3hjea2 b.71.1.0 (A:642-704) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
eykplklqkglcgfmrgdkvlvivktlnrdydieidgeytdvitdetvrgrvkvdklpli
lvk

Timeline for d3hjea2:

• d3hjea2 first appeared in SCOPe 2.03
  
• d3hjea2 appears in SCOPe 2.05
  
• d3hjea2 appears in the current release, SCOPe 2.08