Lineage for d3hjea1 (3hje A:1-641)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084228Species Sulfolobus tokodaii [TaxId:273063] [225871] (1 PDB entry)
  8. 2084229Domain d3hjea1: 3hje A:1-641 [211092]
    Other proteins in same PDB: d3hjea2
    automated match to d1iv8a2
    complexed with gol

Details for d3hjea1

PDB Entry: 3hje (more details), 1.9 Å

PDB Description: Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
PDB Compounds: (A:) 704aa long hypothetical glycosyltransferase

SCOPe Domain Sequences for d3hjea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjea1 c.1.8.0 (A:1-641) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mkllstyrlqpmkfseirnrldyfvelgvthlylspvlkarpgsthgydvvdyntindel
ggeeeyirlideakskglgiiqdivpnhmavhhtnwrlmdvlkkgrhsryynyfdfyeee
ekiripilgdrnfkityvndepyldyygnlfpindegrnylndiekllkvqyyelvdwrd
ypsyrrffavneliavrqelewvfedshskilsfevdgyridhidglfkpeeylrrlknk
ignkhifvekilsigeklrwdfidgttgydflnysnllftdnedkmteiyknildidlde
lvketkkkiidtlfkhdierismmlgvnyeeikeflsclkvyrtyitendfrdeeiirnc
sqkvyesmkknvtafmklqqympavfakayedtvlfiynrlislnevgsdlhyysiscdk
fhefnlkrvgtlsfnatsthdtkfsedvrmrisaiseipdewakkvnewhnilnpnidkn
deyrlyqtivgsfdgfnneykerlkahmikalreakvhtdwvnvnteyekkmtylidkmf
nnekfmesflefeskidkmgkvkslslvalkitspgvadfyqglenfrylltdpdnrrpv
vfselpkryeeglfnngrikayvtkvllnlrksmkdffins

SCOPe Domain Coordinates for d3hjea1:

Click to download the PDB-style file with coordinates for d3hjea1.
(The format of our PDB-style files is described here.)

Timeline for d3hjea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hjea2