Lineage for d3hjbc1 (3hjb C:1-550)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140362Protein automated matches [190137] (5 species)
    not a true protein
  7. 2140395Species Vibrio cholerae [TaxId:666] [225688] (1 PDB entry)
  8. 2140398Domain d3hjbc1: 3hjb C:1-550 [211090]
    Other proteins in same PDB: d3hjba2, d3hjbb2, d3hjbc2, d3hjbd2
    automated match to d1g98a_
    complexed with ca, cl, na, peg, pg4

Details for d3hjbc1

PDB Entry: 3hjb (more details), 1.5 Å

PDB Description: 1.5 angstrom crystal structure of glucose-6-phosphate isomerase from vibrio cholerae.
PDB Compounds: (C:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d3hjbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjbc1 c.80.1.2 (C:1-550) automated matches {Vibrio cholerae [TaxId: 666]}
mlkninptqtqawkaltahfesaqdmdlkalfaqdserfakysarfgqdilvdysknlvn
aetmqhlfalaketdlqsaitamfkgeainqtedravlhtalrnrsnspvlvngedvmpa
vnavlakmkafserviggewkgftgkaitdvvnigiggsdlgpymvtealvpyknhltvh
fvsnvdgthmaetlknvdpettlflvasktfttqetmtnahtardwflkaagdeahvakh
faalstngkavaefgidtdnmfefwdwvggryslwsaiglsiilsigydnfvellagahe
mdqhfvntpfesnipvilaligiwynnfhgaeseailpydqylhrfaayfqqgnmesngk
yvdrngnpvtyqtgpiiwgepgtngqhafyqlihqgtklipcdfiapavshnlvgdhhqk
lmsnffaqtealafgksaqavqaelekagksaaeiaalvpfkvfegnrptnsilvkqitp
rtlgnliamyehkifvqgviwnifsfdqwgvelgkqlanqilpeladsaavtshdsstng
linafkafra

SCOPe Domain Coordinates for d3hjbc1:

Click to download the PDB-style file with coordinates for d3hjbc1.
(The format of our PDB-style files is described here.)

Timeline for d3hjbc1: