| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.0: automated matches [227249] (1 protein) not a true family |
| Protein automated matches [227026] (6 species) not a true protein |
| Species Rhodococcus opacus [TaxId:37919] [225810] (11 PDB entries) |
| Domain d3hj8a_: 3hj8 A: [211087] automated match to d1s9aa_ complexed with 4cl, 6pl, fe |
PDB Entry: 3hj8 (more details), 2.4 Å
SCOPe Domain Sequences for d3hj8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hj8a_ b.3.6.0 (A:) automated matches {Rhodococcus opacus [TaxId: 37919]}
ratadtsperlaaiakdalgalndvilkhgvtypeyrvfkqwlidvgeggewplfldvfi
ehsveevlarsrkgtmgsiegpyyienspelpskctlpmreedekitplvfsgqvtdldg
nglagakvelwhadndgyysqfaphlpewnlrgtiiadeegryeittiqpapyqiptdgp
tgqfieaqnghpwrpahlhlivsapgkesvttqlyfkggewidsdvasatkpelildpkt
gddgknyvtynfvldpa
Timeline for d3hj8a_: