Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
Domain d1aifa2: 1aif A:110-215 [21108] Other proteins in same PDB: d1aifa1, d1aifb1, d1aifb2, d1aifh1, d1aifh2, d1aifl1 |
PDB Entry: 1aif (more details), 2.9 Å
SCOP Domain Sequences for d1aifa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aifa2 b.1.1.2 (A:110-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1aifa2: