SCOPe 2.03: Domain d3hila_: 3hil A:

Lineage for d3hila_ (3hil A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (6 PDB entries)

8. Domain d3hila_: 3hil A: [211077]
   automated match to d3kkaa_
   complexed with cl, no3

Details for d3hila_

PDB Entry: 3hil, 2 Å

PDB Description: SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1)

PDB Compounds: (A:) Ephrin type-A receptor 1

SCOPe Domain Sequences for d3hila_:

Sequence; same for both SEQRES and ATOM records:

>d3hila_ a.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipyrtvsewlesirmkryilhfhsagldtmecvleltaedltqmgitlpghqkrilcsi
qgf

Timeline for d3hila_:

• d3hila_ is new in SCOPe 2.03-stable
  
• d3hila_ appears in SCOPe 2.04
  
• d3hila_ appears in the current release, SCOPe 2.08