Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (3 families) Serine/threonine protein kinase-associated motif embedded in two distinct folds |
Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries) |
Domain d3hiha1: 3hih A:371-494 [211073] automated match to d1q4kc1 complexed with edo, gol, so4 |
PDB Entry: 3hih (more details), 1.7 Å
SCOPe Domain Sequences for d3hiha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hiha1 d.223.1.2 (A:371-494) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl lkag
Timeline for d3hiha1: