Lineage for d3hiha1 (3hih A:371-494)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613471Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2613472Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2613484Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 2613485Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 2613486Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)
  8. 2613495Domain d3hiha1: 3hih A:371-494 [211073]
    automated match to d1q4kc1
    complexed with edo, gol, so4

Details for d3hiha1

PDB Entry: 3hih (more details), 1.7 Å

PDB Description: Structure of human Plk1-PBD with glycerol and sulfate in the phophopeptide binding site
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d3hiha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hiha1 d.223.1.2 (A:371-494) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn
svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl
lkag

SCOPe Domain Coordinates for d3hiha1:

Click to download the PDB-style file with coordinates for d3hiha1.
(The format of our PDB-style files is described here.)

Timeline for d3hiha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hiha2