Lineage for d3hhya_ (3hhy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2770308Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2770309Protein automated matches [227026] (6 species)
    not a true protein
  7. 2770325Species Rhodococcus opacus [TaxId:37919] [225810] (11 PDB entries)
  8. 2770326Domain d3hhya_: 3hhy A: [211065]
    automated match to d1s9aa_
    complexed with 6pl, caq, cl, fe, mg

Details for d3hhya_

PDB Entry: 3hhy (more details), 1.55 Å

PDB Description: Crystal structure determination of Catechol 1,2-Dioxygenase from Rhodococcus opacus 1CP in complex with catechol
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d3hhya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhya_ b.3.6.0 (A:) automated matches {Rhodococcus opacus [TaxId: 37919]}
atadtsperlaaiakdalgalndvilkhgvtypeyrvfkqwlidvgeggewplfldvfie
hsveevlarsrkgtmgsiegpyyienspelpskctlpmreedekitplvfsgqvtdldgn
glagakvelwhadndgyysqfaphlpewnlrgtiiadeegryeittiqpapyqiptdgpt
gqfieaqnghpwrpahlhlivsapgkesvttqlyfkggewidsdvasatkpelildpktg
ddgknyvtynfvldpa

SCOPe Domain Coordinates for d3hhya_:

Click to download the PDB-style file with coordinates for d3hhya_.
(The format of our PDB-style files is described here.)

Timeline for d3hhya_: