Lineage for d3hhxa_ (3hhx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2770308Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2770309Protein automated matches [227026] (6 species)
    not a true protein
  7. 2770325Species Rhodococcus opacus [TaxId:37919] [225810] (11 PDB entries)
  8. 2770342Domain d3hhxa_: 3hhx A: [211064]
    automated match to d1s9aa_
    complexed with 6pl, fe, pyg

Details for d3hhxa_

PDB Entry: 3hhx (more details), 2 Å

PDB Description: crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d3hhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhxa_ b.3.6.0 (A:) automated matches {Rhodococcus opacus [TaxId: 37919]}
atadtsperlaaiakdalgalndvilkhgvtypeyrvfkqwlidvgeggewplfldvfie
hsveevlarsrkgtmgsiegpyyienspelpskctlpmreedekitplvfsgqvtdldgn
glagakvelwhadndgyysqfaphlpewnlrgtiiadeegryeittiqpapyqiptdgpt
gqfieaqnghpwrpahlhlivsapgkesvttqlyfkggewidsdvasatkpelildpktg
ddgknyvtynfvldpa

SCOPe Domain Coordinates for d3hhxa_:

Click to download the PDB-style file with coordinates for d3hhxa_.
(The format of our PDB-style files is described here.)

Timeline for d3hhxa_: