Lineage for d1iaim2 (1iai M:110-215)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221285Species Fab 409.5.3 (mouse), kappa L chain [49025] (2 PDB entries)
  8. 221287Domain d1iaim2: 1iai M:110-215 [21106]
    Other proteins in same PDB: d1iaih1, d1iaii1, d1iail1, d1iaim1

Details for d1iaim2

PDB Entry: 1iai (more details), 2.9 Å

PDB Description: idiotype-anti-idiotype fab complex

SCOP Domain Sequences for d1iaim2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaim2 b.1.1.2 (M:110-215) Immunoglobulin (constant domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1iaim2:

Click to download the PDB-style file with coordinates for d1iaim2.
(The format of our PDB-style files is described here.)

Timeline for d1iaim2: