Lineage for d3hhpd1 (3hhp D:1-145)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846776Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries)
  8. 2846782Domain d3hhpd1: 3hhp D:1-145 [211038]
    Other proteins in same PDB: d3hhpa2, d3hhpb2, d3hhpc2, d3hhpd2
    automated match to d2cmda1

Details for d3hhpd1

PDB Entry: 3hhp (more details), 1.45 Å

PDB Description: Malate dehydrogenase open conformation
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d3hhpd1:

Sequence, based on SEQRES records: (download)

>d3hhpd1 c.2.1.0 (D:1-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

Sequence, based on observed residues (ATOM records): (download)

>d3hhpd1 c.2.1.0 (D:1-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvmdrsdlfnvnagivknlvqqvaktcpkacigiitnpvnttv
aiaaevlkkagvydknklfg

SCOPe Domain Coordinates for d3hhpd1:

Click to download the PDB-style file with coordinates for d3hhpd1.
(The format of our PDB-style files is described here.)

Timeline for d3hhpd1: