![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein automated matches [226882] (9 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [225274] (2 PDB entries) |
![]() | Domain d3hhpb2: 3hhp B:146-311 [211035] Other proteins in same PDB: d3hhpa1, d3hhpb1, d3hhpc1, d3hhpd1 automated match to d2cmda2 |
PDB Entry: 3hhp (more details), 1.45 Å
SCOPe Domain Sequences for d3hhpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhpb2 d.162.1.1 (B:146-311) automated matches {Escherichia coli K-12 [TaxId: 83333]} vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs qplllgkngveerksigtlsafeqnalegmldtlkkdialgeefvn
Timeline for d3hhpb2: