Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries) |
Domain d3hhpb1: 3hhp B:1-145 [211034] Other proteins in same PDB: d3hhpa2, d3hhpb2, d3hhpc2, d3hhpd2 automated match to d2cmda1 |
PDB Entry: 3hhp (more details), 1.45 Å
SCOPe Domain Sequences for d3hhpb1:
Sequence, based on SEQRES records: (download)
>d3hhpb1 c.2.1.0 (B:1-145) automated matches {Escherichia coli K-12 [TaxId: 83333]} mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp vnttvaiaaevlkkagvydknklfg
>d3hhpb1 c.2.1.0 (B:1-145) automated matches {Escherichia coli K-12 [TaxId: 83333]} mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg edatpalegadvvlisagvrsdlfnvnagivknlvqqvaktcpkacigiitnpvnttvai aaevlkkagvydknklfg
Timeline for d3hhpb1: