SCOPe 2.06: Domain d3hhja_: 3hhj A:

Lineage for d3hhja_ (3hhj A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (16 species)
   not a true protein

7. Species Bartonella henselae [TaxId:283166] [225687] (1 PDB entry)

8. Domain d3hhja_: 3hhj A: [211030]
   automated match to d3r03a_
   complexed with mg

Details for d3hhja_

PDB Entry: 3hhj, 2.1 Å

PDB Description: crystal structure of mutator mutt from bartonella henselae

PDB Compounds: (A:) Mutator mutT protein

SCOPe Domain Sequences for d3hhja_:

Sequence; same for both SEQRES and ATOM records:

>d3hhja_ d.113.1.0 (A:) automated matches {Bartonella henselae [TaxId: 283166]}
sllivvacalldqdnrvlltqrpegkslaglwefpggkveqgetpeaslireleeelgvh
vqadnlfpltfashgyetfhllmplyfcshykgvaqgregqnlkwifindldkypmpead
kplvqvlknf

Timeline for d3hhja_:

• d3hhja_ first appeared in SCOPe 2.03
  
• d3hhja_ appears in SCOPe 2.05
  
• d3hhja_ appears in SCOPe 2.07
  
• d3hhja_ appears in the current release, SCOPe 2.08