SCOPe 2.05: Domain d3hgba_: 3hgb A:

Lineage for d3hgba_ (3hgb A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225686] (1 PDB entry)

8. Domain d3hgba_: 3hgb A: [211028]
   automated match to d3ifta_

Details for d3hgba_

PDB Entry: 3hgb, 1.75 Å

PDB Description: crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3hgba_:

Sequence; same for both SEQRES and ATOM records:

>d3hgba_ b.84.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
smsdipsdlhytaehewirrsgddtvrvgitdyaqsalgdvvfvqlpvigtavtagetfg
evestksvsdlyapisgkvsevnsdldgtpqlvnsdpygagwlldiqvdssdvaalesal
ttlldaeayrgtlt

Timeline for d3hgba_:

• d3hgba_ first appeared in SCOPe 2.03
  
• d3hgba_ appears in SCOPe 2.04
  
• d3hgba_ is called d3hgba1 in SCOPe 2.06
  
• d3hgba_ appears in the current release, SCOPe 2.08, called d3hgba1