Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Melibiase [75064] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [102062] (21 PDB entries) alpha-galactosidase A |
Domain d3hg4b1: 3hg4 B:32-323 [211022] Other proteins in same PDB: d3hg4a2, d3hg4b2 automated match to d1r46b2 complexed with 7jz, acy, gal, nag, so4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3hg4 (more details), 2.3 Å
SCOPe Domain Sequences for d3hg4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hg4b1 c.1.8.1 (B:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]} ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp
Timeline for d3hg4b1: