SCOPe 2.06: Domain d3hg4a2: 3hg4 A:324-421

Lineage for d3hg4a2 (3hg4 A:324-421)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
   alpha-galactosidase A

8. Domain d3hg4a2: 3hg4 A:324-421 [211021]
   Other proteins in same PDB: d3hg4a1, d3hg4b1
   automated match to d1r46a1
   complexed with 7jz, acy, gal, nag, so4

Details for d3hg4a2

PDB Entry: 3hg4, 2.3 Å

PDB Description: human alpha-galactosidase catalytic mechanism 3. covalent intermediate

PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3hg4a2:

Sequence; same for both SEQRES and ATOM records:

>d3hg4a2 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

Timeline for d3hg4a2:

• d3hg4a2 first appeared in SCOPe 2.03
  
• d3hg4a2 appears in SCOPe 2.05
  
• d3hg4a2 appears in SCOPe 2.07
  
• d3hg4a2 appears in the current release, SCOPe 2.08