Lineage for d3hfzb5 (3hfz B:475-681)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1663709Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1663847Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 1663848Species Thermus thermophilus [TaxId:274] [55704] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1663858Domain d3hfzb5: 3hfz B:475-681 [211014]
    Other proteins in same PDB: d3hfza_, d3hfzb1, d3hfzb2, d3hfzb3, d3hfzb4, d3hfzb6
    automated match to d1jjcb5
    complexed with mty

Details for d3hfzb5

PDB Entry: 3hfz (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with m-tyrosine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3hfzb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfzb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOPe Domain Coordinates for d3hfzb5:

Click to download the PDB-style file with coordinates for d3hfzb5.
(The format of our PDB-style files is described here.)

Timeline for d3hfzb5: