![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species) this domain is non-catalytic |
![]() | Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d3hfzb5: 3hfz B:475-681 [211014] Other proteins in same PDB: d3hfza_, d3hfzb1, d3hfzb2, d3hfzb3, d3hfzb4, d3hfzb6 automated match to d1jjcb5 protein/RNA complex; complexed with mty |
PDB Entry: 3hfz (more details), 2.9 Å
SCOPe Domain Sequences for d3hfzb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfzb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]} alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga lhpeiaqelelppvhlfelrlplpdkp
Timeline for d3hfzb5: