SCOPe 2.04: Domain d3hfzb4: 3hfz B:400-474

Lineage for d3hfzb4 (3hfz B:400-474)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d3hfzb4: 3hfz B:400-474 [211013]
   Other proteins in same PDB: d3hfza_, d3hfzb2, d3hfzb3, d3hfzb5, d3hfzb6
   automated match to d1jjcb2
   complexed with mty

Details for d3hfzb4

PDB Entry: 3hfz, 2.9 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with m-tyrosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3hfzb4:

Sequence; same for both SEQRES and ATOM records:

>d3hfzb4 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

Timeline for d3hfzb4:

• d3hfzb4 first appeared in SCOPe 2.03
  
• d3hfzb4 appears in SCOPe 2.05
  
• d3hfzb4 appears in the current release, SCOPe 2.08