| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
| Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) duplication: contains two such domains related by pseudo dyad |
| Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
| Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d3hfzb4: 3hfz B:400-474 [211013] Other proteins in same PDB: d3hfza_, d3hfzb2, d3hfzb3, d3hfzb5, d3hfzb6 automated match to d1jjcb2 complexed with mty |
PDB Entry: 3hfz (more details), 2.9 Å
SCOPe Domain Sequences for d3hfzb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfzb4 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl
Timeline for d3hfzb4: