Lineage for d3hfzb4 (3hfz B:400-474)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261200Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1261201Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1261202Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 1261203Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 1261204Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1261224Domain d3hfzb4: 3hfz B:400-474 [211013]
    Other proteins in same PDB: d3hfza_, d3hfzb2, d3hfzb3, d3hfzb5, d3hfzb6
    automated match to d1jjcb2
    complexed with mty

Details for d3hfzb4

PDB Entry: 3hfz (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with m-tyrosine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3hfzb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfzb4 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOPe Domain Coordinates for d3hfzb4:

Click to download the PDB-style file with coordinates for d3hfzb4.
(The format of our PDB-style files is described here.)

Timeline for d3hfzb4: