![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.153: PheT/TilS domain [56036] (1 superfamily) core: 3 layers; contains beta-sandwich of unusual topology |
![]() | Superfamily b.153.1: PheT/TilS domain [56037] (2 families) ![]() contains putative tRNA-binding structural motif |
![]() | Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) Pfam PF03483; decorated with additional structures |
![]() | Protein B3/B4 domain of PheRS, PheT [56039] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56040] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d3hfzb3: 3hfz B:191-399 [211012] Other proteins in same PDB: d3hfza_, d3hfzb1, d3hfzb2, d3hfzb4, d3hfzb5, d3hfzb6 automated match to d1jjcb6 complexed with mty |
PDB Entry: 3hfz (more details), 2.9 Å
SCOPe Domain Sequences for d3hfzb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfzb3 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]} lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv paqrralsllqalagarvaealleagspk
Timeline for d3hfzb3: