SCOPe 2.08: Domain d3hfzb2: 3hfz B:39-151

Lineage for d3hfzb2 (3hfz B:39-151)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d3hfzb2: 3hfz B:39-151 [211011]
   Other proteins in same PDB: d3hfza_, d3hfzb1, d3hfzb3, d3hfzb4, d3hfzb5, d3hfzb6
   automated match to d1jjcb3
   protein/RNA complex; complexed with mty

Details for d3hfzb2

PDB Entry: 3hfz, 2.9 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with m-tyrosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3hfzb2:

Sequence; same for both SEQRES and ATOM records:

>d3hfzb2 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

Timeline for d3hfzb2:

• d3hfzb2 first appeared in SCOPe 2.03
  
• d3hfzb2 appears in SCOPe 2.07