Lineage for d3hfza_ (3hfz A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426349Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1426474Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 1426475Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1426485Domain d3hfza_: 3hfz A: [211009]
    Other proteins in same PDB: d3hfzb1, d3hfzb2, d3hfzb3, d3hfzb4, d3hfzb5, d3hfzb6
    automated match to d1eiya2
    complexed with mty

Details for d3hfza_

PDB Entry: 3hfz (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with m-tyrosine
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d3hfza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfza_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d3hfza_:

Click to download the PDB-style file with coordinates for d3hfza_.
(The format of our PDB-style files is described here.)

Timeline for d3hfza_: