![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d3hfza_: 3hfz A: [211009] Other proteins in same PDB: d3hfzb1, d3hfzb2, d3hfzb3, d3hfzb4, d3hfzb5, d3hfzb6 automated match to d1eiya2 complexed with mty |
PDB Entry: 3hfz (more details), 2.9 Å
SCOPe Domain Sequences for d3hfza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfza_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam lrygipdiryffggrlkfleqfkgvl
Timeline for d3hfza_: