Lineage for d3hc4l1 (3hc4 L:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296010Domain d3hc4l1: 3hc4 L:1-107 [210999]
    Other proteins in same PDB: d3hc4l2
    automated match to d1rhha1
    complexed with act, zn; mutant

Details for d3hc4l1

PDB Entry: 3hc4 (more details), 1.62 Å

PDB Description: BHA10 IgG1 Fab quadruple mutant variant - antibody directed at human LTBR
PDB Compounds: (L:) immunoglobulin IgG1 Fab, light chain

SCOPe Domain Sequences for d3hc4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hc4l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitckasqnvginvawyqqkpgkapkllissasyrysgvps
rfsgsgsgtdftltisslqpedfatyfcqqydtypftfgqgtkveik

SCOPe Domain Coordinates for d3hc4l1:

Click to download the PDB-style file with coordinates for d3hc4l1.
(The format of our PDB-style files is described here.)

Timeline for d3hc4l1: