SCOPe 2.05: Domain d3hc2a2: 3hc2 A:344-466

Lineage for d3hc2a2 (3hc2 A:344-466)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225870] (6 PDB entries)

8. Domain d3hc2a2: 3hc2 A:344-466 [210996]
   Other proteins in same PDB: d3hc2a1
   automated match to d1ogpa1
   complexed with mo, mte; mutant

Details for d3hc2a2

PDB Entry: 3hc2, 2.5 Å

PDB Description: crystal structure of chicken sulfite oxidase mutant tyr 322 phe

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d3hc2a2:

Sequence; same for both SEQRES and ATOM records:

>d3hc2a2 b.1.18.0 (A:344-466) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

Timeline for d3hc2a2:

• d3hc2a2 first appeared in SCOPe 2.03
  
• d3hc2a2 appears in SCOPe 2.04
  
• d3hc2a2 appears in SCOPe 2.06
  
• d3hc2a2 appears in the current release, SCOPe 2.08