| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [225870] (6 PDB entries) |
| Domain d3hc2a2: 3hc2 A:344-466 [210996] Other proteins in same PDB: d3hc2a1 automated match to d1ogpa1 complexed with mo, mte; mutant |
PDB Entry: 3hc2 (more details), 2.5 Å
SCOPe Domain Sequences for d3hc2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hc2a2 b.1.18.0 (A:344-466) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd
Timeline for d3hc2a2: