SCOPe 2.04: Domain d3hc2a1: 3hc2 A:95-343

Lineage for d3hc2a1 (3hc2 A:95-343)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif

4. Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families)

5. Family d.176.1.0: automated matches [227253] (1 protein)
   not a true family

6. Protein automated matches [227034] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225869] (6 PDB entries)

8. Domain d3hc2a1: 3hc2 A:95-343 [210995]
   Other proteins in same PDB: d3hc2a2
   automated match to d1ogpa2
   complexed with mo, mte; mutant

Details for d3hc2a1

PDB Entry: 3hc2, 2.5 Å

PDB Description: crystal structure of chicken sulfite oxidase mutant tyr 322 phe

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d3hc2a1:

Sequence; same for both SEQRES and ATOM records:

>d3hc2a1 d.176.1.0 (A:95-343) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrlr
vdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarw
ggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllayem
ngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndfkgfspcvdwdtv
dyrtapaiq

Timeline for d3hc2a1:

• d3hc2a1 first appeared in SCOPe 2.03
  
• d3hc2a1 appears in SCOPe 2.05
  
• d3hc2a1 appears in the current release, SCOPe 2.08