SCOPe 2.06: Domain d3hc0b2: 3hc0 B:108-213

Lineage for d3hc0b2 (3hc0 B:108-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d3hc0b2: 3hc0 B:108-213 [210992]
   Other proteins in same PDB: d3hc0b1, d3hc0l1
   automated match to d3fcta2
   complexed with act

Details for d3hc0b2

PDB Entry: 3hc0, 1.9 Å

PDB Description: BHA10 IgG1 wild-type Fab - antibody directed at human LTBR

PDB Compounds: (B:) immunoglobulin IgG1 Fab, heavy chain

SCOPe Domain Sequences for d3hc0b2:

Sequence; same for both SEQRES and ATOM records:

>d3hc0b2 b.1.1.2 (B:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3hc0b2:

• d3hc0b2 first appeared in SCOPe 2.03
  
• d3hc0b2 appears in SCOPe 2.05
  
• d3hc0b2 appears in SCOPe 2.07
  
• d3hc0b2 appears in the current release, SCOPe 2.08