Lineage for d3hc0b2 (3hc0 B:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1762879Domain d3hc0b2: 3hc0 B:108-213 [210992]
    Other proteins in same PDB: d3hc0b1, d3hc0l1
    automated match to d3fcta2
    complexed with act

Details for d3hc0b2

PDB Entry: 3hc0 (more details), 1.9 Å

PDB Description: BHA10 IgG1 wild-type Fab - antibody directed at human LTBR
PDB Compounds: (B:) immunoglobulin IgG1 Fab, heavy chain

SCOPe Domain Sequences for d3hc0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hc0b2 b.1.1.2 (B:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3hc0b2:

Click to download the PDB-style file with coordinates for d3hc0b2.
(The format of our PDB-style files is described here.)

Timeline for d3hc0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hc0b1