Lineage for d3hbta2 (3hbt A:147-375)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491291Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2491407Domain d3hbta2: 3hbt A:147-375 [210987]
    automated match to d1qz5a2
    complexed with atp, ca, so4

Details for d3hbta2

PDB Entry: 3hbt (more details), 2.7 Å

PDB Description: The structure of native G-actin
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d3hbta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbta2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d3hbta2:

Click to download the PDB-style file with coordinates for d3hbta2.
(The format of our PDB-style files is described here.)

Timeline for d3hbta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hbta1