SCOPe 2.06: Domain d3hbrb_: 3hbr B:

Lineage for d3hbrb_ (3hbr B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (23 PDB entries)

8. Domain d3hbrb_: 3hbr B: [210983]
   automated match to d1nrfa_
   complexed with edo

Details for d3hbrb_

PDB Entry: 3hbr, 1.9 Å

PDB Description: Crystal structure of OXA-48 beta-lactamase

PDB Compounds: (B:) oxa-48

SCOPe Domain Sequences for d3hbrb_:

Sequence; same for both SEQRES and ATOM records:

>d3hbrb_ e.3.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
p

Timeline for d3hbrb_:

• d3hbrb_ first appeared in SCOPe 2.03
  
• d3hbrb_ appears in SCOPe 2.05
  
• d3hbrb_ appears in SCOPe 2.07
  
• d3hbrb_ appears in the current release, SCOPe 2.08