Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein Thymidylate synthase [55833] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [55840] (24 PDB entries) |
Domain d3hb8a_: 3hb8 A: [210970] automated match to d2aaza_ complexed with edo, po4, ump |
PDB Entry: 3hb8 (more details), 2.74 Å
SCOPe Domain Sequences for d3hb8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hb8a_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]} pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt
Timeline for d3hb8a_:
View in 3D Domains from other chains: (mouse over for more information) d3hb8b_, d3hb8c_, d3hb8d_, d3hb8e_ |