Lineage for d3hb8a_ (3hb8 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1428981Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1429236Protein automated matches [190469] (12 species)
    not a true protein
  7. 1429276Species Human (Homo sapiens) [TaxId:9606] [189245] (13 PDB entries)
  8. 1429291Domain d3hb8a_: 3hb8 A: [210970]
    automated match to d2aaza_
    complexed with edo, po4, ump

Details for d3hb8a_

PDB Entry: 3hb8 (more details), 2.74 Å

PDB Description: structures of thymidylate synthase r163k with substrates and inhibitors show subunit asymmetry
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d3hb8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb8a_ d.117.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d3hb8a_:

Click to download the PDB-style file with coordinates for d3hb8a_.
(The format of our PDB-style files is described here.)

Timeline for d3hb8a_: