Lineage for d3hb7f_ (3hb7 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864233Species Alkaliphilus metalliredigens [TaxId:293826] [225721] (1 PDB entry)
  8. 2864239Domain d3hb7f_: 3hb7 F: [210967]
    Other proteins in same PDB: d3hb7a2, d3hb7b2, d3hb7d2
    automated match to d3lqya_
    complexed with na, nh4

Details for d3hb7f_

PDB Entry: 3hb7 (more details), 2.3 Å

PDB Description: the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a
PDB Compounds: (F:) Isochorismatase hydrolase

SCOPe Domain Sequences for d3hb7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb7f_ c.33.1.0 (F:) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]}
makhailvidmlndfvgekaplrcpggetiipdlqkifewvrgregddihlvhiqeahrk
ndadfrvrplhavkgtwgsdfipelypqedeyivqkrrhsgfahtdldlylkeegidtvv
ltgvwtnvcvrstatdalanaykvitlsdgtaskteemheyglndlsiftkvmtvdqyiq
awe

SCOPe Domain Coordinates for d3hb7f_:

Click to download the PDB-style file with coordinates for d3hb7f_.
(The format of our PDB-style files is described here.)

Timeline for d3hb7f_: