| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
| Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
| Protein automated matches [190499] (26 species) not a true protein |
| Species Alkaliphilus metalliredigens [TaxId:293826] [225721] (1 PDB entry) |
| Domain d3hb7f_: 3hb7 F: [210967] Other proteins in same PDB: d3hb7a2, d3hb7b2, d3hb7d2 automated match to d3lqya_ complexed with na, nh4 |
PDB Entry: 3hb7 (more details), 2.3 Å
SCOPe Domain Sequences for d3hb7f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hb7f_ c.33.1.0 (F:) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]}
makhailvidmlndfvgekaplrcpggetiipdlqkifewvrgregddihlvhiqeahrk
ndadfrvrplhavkgtwgsdfipelypqedeyivqkrrhsgfahtdldlylkeegidtvv
ltgvwtnvcvrstatdalanaykvitlsdgtaskteemheyglndlsiftkvmtvdqyiq
awe
Timeline for d3hb7f_: