Lineage for d3hb7c_ (3hb7 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843896Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843897Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 1843950Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 1843951Protein automated matches [190499] (20 species)
    not a true protein
  7. 1843956Species Alkaliphilus metalliredigens [TaxId:293826] [225721] (1 PDB entry)
  8. 1843959Domain d3hb7c_: 3hb7 C: [210964]
    automated match to d3lqya_
    complexed with na, nh4

Details for d3hb7c_

PDB Entry: 3hb7 (more details), 2.3 Å

PDB Description: the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a
PDB Compounds: (C:) Isochorismatase hydrolase

SCOPe Domain Sequences for d3hb7c_:

Sequence, based on SEQRES records: (download)

>d3hb7c_ c.33.1.0 (C:) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]}
akhailvidmlndfvgekaplrcpggetiipdlqkifewvrgregddihlvhiqeahrkn
dadfrvrplhavkgtwgsdfipelypqedeyivqkrrhsgfahtdldlylkeegidtvvl
tgvwtnvcvrstatdalanaykvitlsdgtaskteemheyglndlsiftkvmtvdqyiqa
we

Sequence, based on observed residues (ATOM records): (download)

>d3hb7c_ c.33.1.0 (C:) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]}
akhailvidmlndfvgekaplrcpggetiipdlqkifewvrgregddihlvhiqeahrkn
rvrplhavkgtwgsdfipelypqedeyivqkrrhsgfahtdldlylkeegidtvvltgvw
tnvcvrstatdalanaykvitlsdgtaskteemheyglndlsiftkvmtvdqyiqawe

SCOPe Domain Coordinates for d3hb7c_:

Click to download the PDB-style file with coordinates for d3hb7c_.
(The format of our PDB-style files is described here.)

Timeline for d3hb7c_: