Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (26 species) not a true protein |
Species Alkaliphilus metalliredigens [TaxId:293826] [225721] (1 PDB entry) |
Domain d3hb7c_: 3hb7 C: [210964] Other proteins in same PDB: d3hb7a2, d3hb7b2, d3hb7d2 automated match to d3lqya_ complexed with na, nh4 |
PDB Entry: 3hb7 (more details), 2.3 Å
SCOPe Domain Sequences for d3hb7c_:
Sequence, based on SEQRES records: (download)
>d3hb7c_ c.33.1.0 (C:) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]} akhailvidmlndfvgekaplrcpggetiipdlqkifewvrgregddihlvhiqeahrkn dadfrvrplhavkgtwgsdfipelypqedeyivqkrrhsgfahtdldlylkeegidtvvl tgvwtnvcvrstatdalanaykvitlsdgtaskteemheyglndlsiftkvmtvdqyiqa we
>d3hb7c_ c.33.1.0 (C:) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]} akhailvidmlndfvgekaplrcpggetiipdlqkifewvrgregddihlvhiqeahrkn rvrplhavkgtwgsdfipelypqedeyivqkrrhsgfahtdldlylkeegidtvvltgvw tnvcvrstatdalanaykvitlsdgtaskteemheyglndlsiftkvmtvdqyiqawe
Timeline for d3hb7c_: