SCOPe 2.08: Domain d3hb7a1: 3hb7 A:1-184

Lineage for d3hb7a1 (3hb7 A:1-184)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (26 species)
   not a true protein

7. Species Alkaliphilus metalliredigens [TaxId:293826] [225721] (1 PDB entry)

8. Domain d3hb7a1: 3hb7 A:1-184 [210962]
   Other proteins in same PDB: d3hb7a2, d3hb7b2, d3hb7d2
   automated match to d3lqya_
   complexed with na, nh4

Details for d3hb7a1

PDB Entry: 3hb7, 2.3 Å

PDB Description: the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a

PDB Compounds: (A:) Isochorismatase hydrolase

SCOPe Domain Sequences for d3hb7a1:

Sequence; same for both SEQRES and ATOM records:

>d3hb7a1 c.33.1.0 (A:1-184) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]}
makhailvidmlndfvgekaplrcpggetiipdlqkifewvrgregddihlvhiqeahrk
ndadfrvrplhavkgtwgsdfipelypqedeyivqkrrhsgfahtdldlylkeegidtvv
ltgvwtnvcvrstatdalanaykvitlsdgtaskteemheyglndlsiftkvmtvdqyiq
awen

Timeline for d3hb7a1:

• d3hb7a1 first appeared in SCOPe 2.03, called d3hb7a_
  
• d3hb7a1 appears in SCOPe 2.07