Lineage for d3hb5x_ (3hb5 X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842552Protein Human estrogenic 17beta-hydroxysteroid dehydrogenase [51772] (1 species)
  7. 2842553Species Human (Homo sapiens) [TaxId:9606] [51773] (22 PDB entries)
    Uniprot P14061
  8. 2842568Domain d3hb5x_: 3hb5 X: [210961]
    automated match to d1jtva_
    complexed with e2b, nap

Details for d3hb5x_

PDB Entry: 3hb5 (more details), 2 Å

PDB Description: binary and ternary crystal structures of a novel inhibitor of 17 beta- hsd type 1: a lead compound for breast cancer therapy
PDB Compounds: (X:) Estradiol 17-beta-dehydrogenase 1

SCOPe Domain Sequences for d3hb5x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb5x_ c.2.1.2 (X:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevf

SCOPe Domain Coordinates for d3hb5x_:

Click to download the PDB-style file with coordinates for d3hb5x_.
(The format of our PDB-style files is described here.)

Timeline for d3hb5x_: