SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3haba2 (3hab A:509-766)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135563Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 protein domains)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2135570Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2135571Species Human (Homo sapiens) [TaxId:9606] [82499] (55 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2135576Domain d3haba2: 3hab A:509-766 [210951]
    Other proteins in same PDB: d3haba1, d3habb1
    automated match to d1orva2
    complexed with 677, na, nag, ndg

Details for d3haba2

PDB Entry: 3hab (more details), 2.1 Å

PDB Description: The structure of DPP4 in complex with piperidine fused benzimidazole 25
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3haba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3haba2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3haba2:

Click to download the PDB-style file with coordinates for d3haba2.
(The format of our PDB-style files is described here.)

Timeline for d3haba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3haba1