![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
![]() | Domain d1mlca2: 1mlc A:109-214 [21094] Other proteins in same PDB: d1mlca1, d1mlcb1, d1mlcb2, d1mlcc1, d1mlcd1, d1mlcd2, d1mlce_, d1mlcf_ |
PDB Entry: 1mlc (more details), 2.1 Å
SCOP Domain Sequences for d1mlca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlca2 b.1.1.2 (A:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1mlca2: