SCOPe 2.04: Domain d3h9ye2: 3h9y E:439-544

Lineage for d3h9ye2 (3h9y E:439-544)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3h9ye2: 3h9y E:439-544 [210925]
   automated match to d1f6ab2
   complexed with nh4

Details for d3h9ye2

PDB Entry: 3h9y, 2.23 Å

PDB Description: crystal structure of the ige-fc3-4 domains

PDB Compounds: (E:) ig epsilon chain c region

SCOPe Domain Sequences for d3h9ye2:

Sequence; same for both SEQRES and ATOM records:

>d3h9ye2 b.1.1.2 (E:439-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn

Timeline for d3h9ye2:

• d3h9ye2 first appeared in SCOPe 2.03
  
• d3h9ye2 appears in SCOPe 2.05
  
• d3h9ye2 appears in the current release, SCOPe 2.08