SCOPe 2.05: Domain d3h9na1: 3h9n A:8-101

Lineage for d3h9na1 (3h9n A:8-101)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (19 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [225682] (1 PDB entry)

8. Domain d3h9na1: 3h9n A:8-101 [210917]
   Other proteins in same PDB: d3h9na2
   automated match to d2f1la2
   complexed with so4

Details for d3h9na1

PDB Entry: 3h9n, 2.7 Å

PDB Description: Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target IR66.

PDB Compounds: (A:) Ribosome maturation factor rimM

SCOPe Domain Sequences for d3h9na1:

Sequence; same for both SEQRES and ATOM records:

>d3h9na1 b.43.3.0 (A:8-101) automated matches {Haemophilus influenzae [TaxId: 727]}
hievvgklgstygirgwlriyssteqaesifdyqpwflkikgewqsielenwryhnheii
vklkgvddreaaqilanveigvdlsvfpeleegd

Timeline for d3h9na1:

• d3h9na1 first appeared in SCOPe 2.03
  
• d3h9na1 appears in SCOPe 2.04
  
• d3h9na1 appears in SCOPe 2.06
  
• d3h9na1 appears in the current release, SCOPe 2.08