Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [225682] (1 PDB entry) |
Domain d3h9na1: 3h9n A:8-101 [210917] Other proteins in same PDB: d3h9na2 automated match to d2f1la2 complexed with so4 |
PDB Entry: 3h9n (more details), 2.7 Å
SCOPe Domain Sequences for d3h9na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h9na1 b.43.3.0 (A:8-101) automated matches {Haemophilus influenzae [TaxId: 727]} hievvgklgstygirgwlriyssteqaesifdyqpwflkikgewqsielenwryhnheii vklkgvddreaaqilanveigvdlsvfpeleegd
Timeline for d3h9na1: