Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein Thymidylate synthase [55833] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries) |
Domain d3h9kc_: 3h9k C: [210914] automated match to d2aaza_ complexed with edo, po4, ufp |
PDB Entry: 3h9k (more details), 2.65 Å
SCOPe Domain Sequences for d3h9kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h9kc_ d.117.1.1 (C:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]} pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl kiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt
Timeline for d3h9kc_:
View in 3D Domains from other chains: (mouse over for more information) d3h9ka_, d3h9kb_, d3h9kd_, d3h9ke_ |