SCOP 1.71: Domain d1ibgh2: 1ibg H:114-223

Lineage for d1ibgh2 (1ibg H:114-223)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1ibgh2: 1ibg H:114-223 [21091]
   Other proteins in same PDB: d1ibgh1, d1ibgl1, d1ibgl2
   part of Fab 40-50
   complexed with cu, obn

Details for d1ibgh2

PDB Entry: 1ibg, 2.7 Å

PDB Description: structure and specificity of the anti-digoxin antibody 40-50

SCOP Domain Sequences for d1ibgh2:

Sequence; same for both SEQRES and ATOM records:

>d1ibgh2 b.1.1.2 (H:114-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgcgdttgssvtsgclvkgyfpepvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkkl

Timeline for d1ibgh2:

• d1ibgh2 first appeared (with stable ids) in SCOP 1.55
  
• d1ibgh2 appears in SCOP 1.69
  
• d1ibgh2 appears in SCOP 1.73
  
• d1ibgh2 appears in the current release, SCOPe 2.08